PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_010692-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family WRKY
Protein Properties Length: 105aa    MW: 11852.7 Da    PI: 10.4717
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_010692-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1001.4e-3143101159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    +dDg++W+KYG+K+vk+ +fpr+YYrC+ +gCpvkk++er+a+dp+ v++tYeg+Hnhe
  NNU_010692-RA  43 MDDGFKWKKYGKKMVKNRPFPRNYYRCSVEGCPVKKRIERDADDPQHVITTYEGTHNHE 101
                    69********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.809.1E-3431103IPR003657WRKY domain
SuperFamilySSF1182905.23E-2935103IPR003657WRKY domain
PROSITE profilePS5081130.43538103IPR003657WRKY domain
SMARTSM007748.2E-3343102IPR003657WRKY domain
PfamPF031062.6E-2544101IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 105 aa     Download sequence    Send to blast
MTPAIAAALK LKGLAGVTCK RRGTNKAVGA RVVFRTKTEL DIMDDGFKWK KYGKKMVKNR  60
PFPRNYYRCS VEGCPVKKRI ERDADDPQHV ITTYEGTHNH ESPSA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A2e-2830103174WRKY transcription factor 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010273969.13e-47PREDICTED: probable WRKY transcription factor 50
SwissprotQ8VWQ56e-40WRK50_ARATH; Probable WRKY transcription factor 50
TrEMBLA0A059CLX92e-39A0A059CLX9_EUCGR; Uncharacterized protein
STRINGVIT_04s0008g01470.t011e-38(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26170.11e-40WRKY DNA-binding protein 50